Protein or peptide name:	Brk1
Chromosome:	5
Protein or peptide start site:	222623990
Protein or peptide end site:	22264217
ncRNA start site:	222622762
ncRNA end site:	222624303
Genome Browser:	NA
Protein or peptide sequence:	MGRGGGMGNPYNYGIAYQADWENREFISNISLNYRRLFDFLLRFEATTKSKLASLNEKLDILERKLEYLEYQYGSATTNPSYFN
Protein or peptide length:	84aa
ncRNA type:	lncRNA
ncRNA name:	brk1
Entrez ID:	NA
Experimental species:	Zea mays
Experimental techniques:	Northern blot/Western blotting
Experimental sample (cell line and/or tissue):	Maize Leaf Epidermal Cells
Description:	The Brk1 gene encodes a novel, 8 kD protein that is highly conserved in plants and animals, suggesting that BRK1-related proteins may function in actin-dependent aspects of cell polarization in a wide spectrum of eukaryotic organisms.
Subcellular location:	NA
Function:	The sPEP promotes multiple actin-dependent cell polarization events in the developing leaf epidermis; brk1 is orthologous to HSPC300.
Title of paper:	A small, novel protein highly conserved in plants and animals promotes the polarized growth and division of maize leaf epidermal cells
PMID:	12015123
Year of publication:	2012